General Information

  • ID:  hor000298
  • Uniprot ID:  O08677
  • Protein name:  Bradykinin
  • Gene name:  Kng1
  • Organism:  Mus musculus (Mouse)
  • Family:  Bradykinin family
  • Source:  Animal
  • Expression:  Plasma.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0002020 protease binding; GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0006954 inflammatory response; GO:0007162 negative regulation of cell adhesion; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007596 blood coagulation; GO:0007599 hemostasis; GO:0030195 negative regulation of blood coagulation; GO:0031640 killing of cells of another organism; GO:0042311 vasodilation; GO:0045861 negative regulation of proteolysis; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043204 perikaryon

Sequence Information

  • Sequence:  RPPGFSPFR
  • Length:  9(380-388)
  • Propeptide:  MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVIEGTKTDGSPTFYSFKYLIKEGNCSAQSGLAWQDCDFKDAEEAATGECTATVGKRENEFFIVTQTCKIAPSKAPILKAYFPCIGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRKVKSAHRQVVAGLNFDITYTIVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKIANFSQSCTLYSGDDL
  • Signal peptide:  MKLITTLLLCSGLLLTLTQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Influence in smooth muscle contraction,induction of hypotension,natriuresis and diuresis,decrease in blood glucose level,it is a mediator of inflammation and causes ; increase in vascular permeability;stimulation of nociceptors ; release of other mediator
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  1743 seconds ( PubMed ID: 8395230 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O08677-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000298_AF2.pdbhor000298_ESM.pdb

Physical Information

Mass: 120307 Formula: C50H73N15O11
Absent amino acids: ACDEHIKLMNQTVWY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -104.44 Boman Index: -2634
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 0
Instability Index: 12191.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9199253##8395230
  • Title:  Molecular Cloning of cDNAs for Mouse Low-Molecular-Weight and High-Molecular-Weight Prekininogens